PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011079031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GeBP
Protein Properties Length: 362aa    MW: 40021.3 Da    PI: 4.7171
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011079031.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573108.45.1e-34147240497
          DUF573   4 qrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                      rlws+eDei+lL G+idf++ +g +p +d+ afy+fvk+++++++ ++ql +Ki r+Kk+f +  kk  +g +p+fsk+h++ +felskkiW+
  XP_011079031.1 147 TRLWSNEDEIALLNGMIDFTNVKGLDPNADMGAFYDFVKGKLQVDFARDQLRTKISRMKKRFLNALKKGGNGLDPVFSKPHEDMTFELSKKIWD 240
                     79*******************************************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045049.3E-30147240IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MAPKAPSHSR QPTKEKEEKE EPSSEEEESD PSEEEKGNFS DEEEEEGSSD DEGEDQEKVK  60
SNTTTISVAK FGSKSIVQEN GSDSDPDSEG SPSDYKLQPI AKSSVVSAKR AHEEGDSDQQ  120
SLRSGKKSRT GEKQSSATPG GGVGCITRLW SNEDEIALLN GMIDFTNVKG LDPNADMGAF  180
YDFVKGKLQV DFARDQLRTK ISRMKKRFLN ALKKGGNGLD PVFSKPHEDM TFELSKKIWD  240
FAVGNSEGGK KGDNAKKGIL KAEKIGVDEK EIANKEKEGG EQDFWSKYRY VNESFHNIEG  300
NFPSLAMSEA GMSFVRERLS LIGSVKAKEL DDKWKQLIAA EAELNYKMLA LMTEQVKMAF  360
GQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011079031.10.0PREDICTED: mediator-associated protein 1
TrEMBLA0A022RSQ17e-88A0A022RSQ1_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23692041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.14e-24DNA-binding storekeeper protein-related transcriptional regulator